PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_23536
Common NameKK1_024223
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family NF-YB
Protein Properties Length: 214aa    MW: 24214.8 Da    PI: 5.9525
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_23536genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB175.17.1e-5540135297
          NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                    +e drflPianv+rimkkv+P n+kiskdaketvqecvsefisfvt+easdkcqrekrkting+d++wa++tlGfedyveplk yl+ky+e+egek
  C.cajan_23536  40 KEMDRFLPIANVGRIMKKVIPPNGKISKDAKETVQECVSEFISFVTGEASDKCQREKRKTINGEDVIWAITTLGFEDYVEPLKSYLQKYKEIEGEK 135
                    799******************************************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.107.8E-5336162IPR009072Histone-fold
SuperFamilySSF471132.95E-4043146IPR009072Histone-fold
PfamPF008081.1E-2745109IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006154.2E-217391No hitNo description
PROSITE patternPS0068507692IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006154.2E-2192110No hitNo description
PRINTSPR006154.2E-21111129No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MDPDESHGTL PNGFNTGSPE SPCLKTSTNT TPTTHNNNNK EMDRFLPIAN VGRIMKKVIP  60
PNGKISKDAK ETVQECVSEF ISFVTGEASD KCQREKRKTI NGEDVIWAIT TLGFEDYVEP  120
LKSYLQKYKE IEGEKLNIPK QLRSEQRLQH HPHNSNQDEN NQTFNGAYAS TNLISQPPYV  180
ASDQKFSSLP FSPNSIQSQL RQQDQIDSVG HWYE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A4e-4440130393NF-YB
4csr_A4e-4440130494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B4e-4440130494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524310.11e-128PREDICTED: nuclear transcription factor Y subunit B-7-like
SwissprotQ9SIT95e-68NFYB7_ARATH; Nuclear transcription factor Y subunit B-7
TrEMBLA0A151TLE81e-161A0A151TLE8_CAJCA; Nuclear transcription factor Y subunit B-7
STRINGGLYMA05G32680.11e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF132492430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G13570.17e-68nuclear factor Y, subunit B7